PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10018592m
Common NameCARUB_v10018592mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 261aa    MW: 29821.7 Da    PI: 8.5922
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10018592mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.5e-152067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l   v ++G g+W+tI+   g+ R +k+c++rw +yl
  Carubv10018592m 20 KGLWSPEEDEKLRSHVLKYGHGCWSTIPILTGLQRNGKSCRLRWVNYL 67
                     678*******************************************97 PP

2Myb_DNA-binding49.59.5e-1674117247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +T+eE+  lv ++ +lG++ W+ I++ ++ gRt++++k++w++ 
  Carubv10018592m  74 STFTKEEETTLVSLHSMLGNK-WSQISKFLP-GRTDNEIKNYWHSN 117
                      689******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-221470IPR009057Homeodomain-like
PROSITE profilePS5129416.4891567IPR017930Myb domain
SuperFamilySSF466894.03E-3019114IPR009057Homeodomain-like
SMARTSM007172.5E-111969IPR001005SANT/Myb domain
PfamPF002492.2E-132067IPR001005SANT/Myb domain
CDDcd001678.44E-102367No hitNo description
PROSITE profilePS5129424.1268122IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-2471121IPR009057Homeodomain-like
SMARTSM007175.2E-1572120IPR001005SANT/Myb domain
PfamPF002492.6E-1473117IPR001005SANT/Myb domain
CDDcd001671.23E-1075118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MVYKSEKPNR KMKSKEKQRK GLWSPEEDEK LRSHVLKYGH GCWSTIPILT GLQRNGKSCR  60
LRWVNYLRPG LKKSTFTKEE ETTLVSLHSM LGNKWSQISK FLPGRTDNEI KNYWHSNLKK  120
GVSLTKHVTT RTPQTSSVKS SLEALQSTTE RSSSSISVGE TFNAQTPSFL PSLVFSEWLD  180
YSLFTDQSPQ KTSYVQNSVV HEERRFTGPC GTLYLEDSSL PDFVPTSEFL LEDEISEIEF  240
CPSFSDNFLF DGLINELRPM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-272012227128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195960.0AY519596.1 Arabidopsis thaliana MYB transcription factor (At3g48920) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292379.10.0hypothetical protein CARUB_v10018592mg
SwissprotQ9M0K44e-59LAF1_ARATH; Transcription factor LAF1
TrEMBLR0FRN70.0R0FRN7_9BRAS; Uncharacterized protein
STRINGAT3G48920.11e-149(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G48920.11e-142myb domain protein 45